PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.6G246200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 249aa    MW: 27474.6 Da    PI: 8.3112
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.6G246200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.6e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++lv ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Sevir.6G246200.1.p 14 KGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                        79******************************99************97 PP

2Myb_DNA-binding57.14.2e-1867111147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg++T++Ed+l+v ++ +lG++ W++Ia++++ gRt++++k++w+++
  Sevir.6G246200.1.p  67 RGNFTPDEDDLIVSLHSLLGNK-WSLIAARLP-GRTDNEIKNYWNTH 111
                         89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.58961IPR017930Myb domain
SuperFamilySSF466891.54E-2913108IPR009057Homeodomain-like
SMARTSM007171.9E-131363IPR001005SANT/Myb domain
PfamPF002494.4E-151461IPR001005SANT/Myb domain
CDDcd001674.22E-111661No hitNo description
PROSITE profilePS512942862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2765116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002491.3E-1667111IPR001005SANT/Myb domain
CDDcd001679.06E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDDRLVAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TPDEDDLIVS LHSLLGNKWS LIAARLPGRT DNEIKNYWNT HIRRKLLARG  120
IDPVTHRPVA ADVGGVTTIS FHPPPPQQQL KPPPRCPDLN LDLCISPPCH QQEEEDDQPL  180
DVEVDLIKPV VVVKREVLQA GHGHGSRGAL CFGCSLGLQK GAPGCSCSDS HFLGLRAGML  240
DFRGLEMK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-281311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF2991851e-154JF299185.1 Panicum virgatum R2R3-MYB transcriptional factor PvMYB4a mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974147.11e-170PREDICTED: myb-related protein Zm38-like
SwissprotP200251e-135MYB38_MAIZE; Myb-related protein Zm38
TrEMBLK3YLF71e-166K3YLF7_SETIT; Uncharacterized protein
STRINGSi015081m1e-166(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-89myb domain protein 4